|
|
Difference between revisions of "buildModel.pl"
| Line 24: | Line 24: | ||
Furthermore, Modeller needs to be installed and available. The script will | Furthermore, Modeller needs to be installed and available. The script will | ||
| − | try to guess the location of the Modeller | + | try to guess the location of the Modeller script that can be called with |
| + | a Modeller input file, but it is better | ||
to provide the location through the environment variable <TT>MODELLEREXEC</TT><BR> | to provide the location through the environment variable <TT>MODELLEREXEC</TT><BR> | ||
Revision as of 14:49, 30 July 2009
Usage
usage: buildModel.pl [options] [fastaFile]
options: [-models value]
[-maxloop value]
[-verbose]
[-nocenter]
[-stats file]
[-pdbdir name]
Description
This script is used for template-based structure prediction. It takes an alignment file in FASTA file as input, finds the PDB template, builds
a homology model and adds missing (loop) residues via Modeller.
A typical input file is expected to look as follows:
>TARGET RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNAAFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP >1IHG_A ::4e-96::61::Chain A, Bovine Cyclophilin 40, Monoclinic Form NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK-GEKPAKLCVIAECGEL..
Note the PDB code and chain ID in the third line. A properly formatted file
can be generated with the psiblast.pl tool from PSI-Blast output.
For this tool to work, it is necessary to have a local copy of the PDB (or
at least a directory where the structures for the needed templates are
present) either at the location pointed to by the environment variable PDBDIR or given through the option -pdbdir.
Furthermore, Modeller needs to be installed and available. The script will
try to guess the location of the Modeller script that can be called with
a Modeller input file, but it is better
to provide the location through the environment variable MODELLEREXEC
Options
- -help
- usage information
